Staging preview: health content pending qualified review
D2C Peptides
IGF-1 vial

IGF-1 0.1 mg to 1 mg

Also searched as: igf-1 lr3, igf 1 lr3

Sold as IGF-1.0 - 1mg and IGF-0.1 - 0.1mg

$35 In stock

Strength
Ships from

For research use only. Not for human or veterinary use.

Ships from the USA or Canada. Shipping details

These IGF-1 vials hold IGF-1 LR3 (Long R3 IGF-I), a lab-made variant of insulin-like growth factor 1, the hormone that manages the effects of growth hormone.612 It has 83 amino acids to native IGF-1's 70 and binds IGF-binding proteins about 1,000 times more weakly.345 Each vial holds white freeze-dried powder, in 0.1 mg, 1 mg sizes.6 Published studies of it are in cells and animals; ClinicalTrials.gov lists no human trial.24257

Specifications

Compound in the vialIGF-1 LR3 (Long R3 IGF-I, also written Long [Arg3]-IGF-I), per the supplier's specification sequence63
ClassIGF-1 analog first made as a recombinant protein in E. coli (a protein in FDA GSRS)218
Sequence (one-letter code)MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (83 amino acids)3
Molecular formulaC400H623N111O115S9 (FDA GSRS estimate)9
Molar massAbout 9.1 kDa (GSRS calculated estimate 9120.0 Da; 9110.45 Da measured on a lot certificate)1011
CAS number143045-27-6 (FDA GSRS and the lot certificate)1213
PubChem CIDNone found; the PubChem records for Long R3 IGF-1 are vendor-deposited substance entries with no linked compound14
UNIIM9L22Y19H9 (an FDA substance identifier, not a drug approval)8
FormWhite freeze-dried (lyophilized) solid6
Vial contents0.1 mg, 1 mg of IGF-1 LR3 per vial (listed sizes)
Strengths0.1 mg, 1 mg
Ships fromUSA, Canada
CategoriesHealing and Recovery Peptides, Muscle Growth Peptides, Weight Loss Peptides
StoragePeptide makers advise storing freeze-dried peptides at -20 °C, dry and away from bright light, and allow a refrigerator at 4 °C for short-term use.1516 These are general peptide guidelines, not tested stability limits for this vial.

Supplies for IGF-1

Bulk and wholesale orders

Labs planning larger IGF-1 studies can apply for a wholesale account. Bulk terms are confirmed on application.

Wholesale detailsApply for a wholesale account

Questions about IGF-1

About IGF-1

IGF-1 (insulin-like growth factor 1) is a 70-amino-acid hormone that manages the effects of growth hormone in the body.14 The compound in these vials is a lab-made variant, IGF-1 LR3, according to the supplier's specification sequence.63 LR3 adds 13 amino acids to the front of human IGF-1 (the first 11 of pig growth hormone, then two more) and replaces the glutamate at position 3 with arginine.2023 A 1992 paper that described it called such analogues very useful reagents for studying how IGF-1 acts.21

These changes cut LR3's binding to IGF-binding proteins about a thousandfold, which its developers linked to its higher potency in rat muscle cells.522 All findings below come from cell and rat studies; ClinicalTrials.gov lists no human study (searched October 2026).7 IGF-1 for sale here comes as research vials, with the IGF-1 price for each size in the selector above. Read What is IGF-1? for the full research summary before you buy IGF-1 online.

Research highlights

  • Muscle cells (rat L6 myoblasts, 1992 and 1993): LR3 stimulated protein and DNA synthesis and slowed protein breakdown, with 5 to 10 times the potency of IGF-1.2422
  • Receptor binding (1992): LR3 binds the type 1 IGF receptor about 3 times less well than IGF-1, yet in steroid-treated rats it was about 2.5 times more potent.2328
  • Growing female rats (14 days by implanted pump): IGF-1 raised weight gain, nitrogen retention and food conversion efficiency, and LR3 was 6 times more potent for growth.2526
  • Steroid-treated male rats (7 days): IGF-1 partly reversed the wasting caused by dexamethasone, and the added carcass weight in IGF-treated rats reflected nitrogen (protein) rather than fat.2729
  • Diabetic rats: LR3 restored growth with 2.5 to 3 times the potency of IGF-1, and the IGF peptides raised muscle protein synthesis by up to 50%.3031
  • Clearance (rats): LR3 was removed from the blood much faster than IGF-1, which the authors tie to its poor binding to plasma IGF-binding proteins.32

Regulatory status

IGF-1 LR3 is not an approved drug: a 2020 FDA warning letter to a compounding pharmacy said IGF1-LR3 is not a component of any FDA-approved human drug and is not on the 503A bulks list, so drugs compounded from it did not qualify for the section 503A exemptions.34 Human IGF-1 is approved as mecasermin (Increlex), a prescription injection first approved on August 30, 2005.3319 Its current label covers growth failure in children aged 2 and older with severe primary IGF-1 deficiency, or with a growth hormone gene deletion and neutralizing antibodies to growth hormone.18 The World Anti-Doping Agency bans IGF-1 and its analogues (class S2.3) at all times, in and out of competition.3536

Handling and storage

Peptide makers note that stability depends on each sequence.15 The LR3 sequence contains three methionines and six cysteines,3 amino acids they flag for oxidation and shorter shelf life, so vials are best kept tightly capped with little air exposure.1517 Warm a cold vial to room temperature before opening it, and reseal it quickly.17

The powder is dissolved in a suitable diluent before lab use; bacteriostatic water is sold separately. The reconstitution guide covers sterile technique, and the reconstitution calculator works out the concentration for a chosen volume of diluent.

Frequently asked questions

Where can I buy IGF-1 LR3 online?

On this page. D2C Peptides lists IGF-1 LR3 as freeze-dried research vials in 0.1 mg, 1 mg sizes. The listings are named IGF-1, but the supplier's specification gives the 83-amino-acid LR3 sequence, and the one lot certificate reviewed matched LR3 by mass.611 Native IGF-1, the 70-amino-acid hormone, is a different molecule.4

Where does IGF-1 ship from?

Orders go out from the USA and Canada to addresses across the United States. If a vial size has more than one shipping origin, the selector names each origin and whether it is in stock, so you can choose before checkout. The shipping page explains origins and lists timing and charges once they are confirmed.

How should IGF-1 be stored when it arrives?

Freeze-dried peptides can be shipped at room temperature.16 On arrival, move the sealed vial to a freezer (-20 °C) for long-term storage, or to a refrigerator (4 °C) if it will be used soon.1516 Dissolve only what a study needs, since peptides in solution break down much faster than the powder.15

Is there a certificate of analysis for IGF-1?

Lot documents are listed on the lab results page when they are published. The one certificate reviewed covers a 0.1 mg vial, lot number 2025-02-13, analyzed February 19, 2025. Its mass spectrometry result, 9110.45 Da against an expected 9111.40 Da, matched IGF-1 LR3, and its HPLC purity was 82.50%.1113 Check that any certificate matches your lot and vial size.

What supplies are used with an IGF-1 vial?

The powder is dissolved in a diluent such as bacteriostatic water, then measured with insulin syringes, with alcohol swabs for clean technique. The reconstitution calculator gives the concentration for a chosen volume of diluent. These are lab handling steps, not directions for use in people.

Is IGF-1 LR3 approved for human use?

No. In a 2020 warning letter, FDA said IGF1-LR3 is not a component of any FDA-approved human drug,34 and ClinicalTrials.gov lists no human study of it.7 Recombinant human IGF-1 is approved as mecasermin (Increlex), a prescription injection for growth failure in children aged 2 and older with severe primary IGF-1 deficiency.41819 These vials are sold under this label: For research use only. Not for human or veterinary use.

Written by D2C Peptides Editorial Team.

Pending qualified review.

Updated .

Sources

  1. IGF-1 (Insulin-Like Growth Factor-1) Test: what it is. MedlinePlus, U.S. National Library of Medicine, 2024.
  2. Tomas et al. 1993 (J Endocrinol), abstract: description of LR3IGF-I. Journal of Endocrinology (PubMed PMID 8371075), 1993.
  3. GSRS substance record UNII M9L22Y19H9 (IGF-1 LR3): protein sequence. U.S. FDA and NCATS Global Substance Registration System (GSRS), 2026.
  4. INCRELEX prescribing information revised 07/2025: 11 Description. U.S. Food and Drug Administration (Drugs@FDA label, BLA 021839), 2025.
  5. Effects of interactions between IGFBPs and IGFs on the plasma clearance and in vivo biological activities of IGFs and IGF analogs (Ballard et al.), abstract: binding affinity. Growth Regulation (PubMed PMID 7683526), 1993.
  6. Supplier product specification.
  7. ClinicalTrials.gov API query: all fields for 'IGF-1 LR3', 'Long R3 IGF-I', 'LR3 IGF-1', 'Long R3 IGF-1' or 'LongR3' (run October 24, 2026). ClinicalTrials.gov, U.S. National Library of Medicine, 2026.
  8. Same source as 3: LONG-(ARG3)INSULIN-LIKE GROWTH FACTOR-I: substance class (a substance registration record, not a drug approval).
  9. Same source as 3: molecular formula (estimated).
  10. Same source as 3: MOL_WEIGHT:NUMBER(CALCULATED).
  11. Supplier certificate of analysis.
  12. Same source as 3: CAS code.
  13. Same source as 11.
  14. PubChem Substance SIDs 476298412 and 488289282: LONG R3 IGF-1 (human), vendor-deposited records with no linked compound (CID). PubChem (NCBI, U.S. National Library of Medicine), 2026.
  15. Peptide Storage and Handling Guidelines. GenScript.
  16. Handling and Storage Guidelines for Peptides (Peptide Guide, chapter 8). Bachem.
  17. Care and Handling of Peptides. Bachem, 2021.
  18. Same source as 4: INCRELEX (mecasermin) injection, prescribing information revised 07/2025: Highlights, Indications and Usage.
  19. Drugs@FDA: INCRELEX, BLA 021839 (product and marketing status). U.S. Food and Drug Administration (Drugs@FDA), 2026.
  20. Francis et al. 1992, abstract: structure of the fusion analogues. Journal of Molecular Endocrinology (PubMed PMID 1378742), 1992.
  21. Same source as 20: Novel recombinant fusion protein analogues of insulin-like growth factor (IGF)-I indicate the relative importance of IGF-binding protein and receptor binding for enhanced biological potency (Francis et al.), abstract.
  22. Same source as 5: Ballard et al. 1993, abstract: potency in L6 myoblasts.
  23. Tomas et al. 1992 (Biochem J), abstract: receptor binding of LR3IGF-I. Biochemical Journal (PubMed PMID 1371669), 1992.
  24. Same source as 20: potency in L6 myoblasts.
  25. Same source as 2: Anabolic effects of insulin-like growth factor-I (IGF-I) and an IGF-I variant in normal female rats (Tomas et al.), abstract: design and effects.
  26. Same source as 5: Ballard et al. 1993, abstract: growth potency in rats.
  27. Same source as 23: catabolic model.
  28. Same source as 23: Insulin-like growth factor-I (IGF-I) and especially IGF-I variants are anabolic in dexamethasone-treated rats (Tomas et al.), abstract: relative potency.
  29. Same source as 23: carcass composition.
  30. Insulin-like growth factor-I and more potent variants restore growth of diabetic rats without inducing all characteristic insulin effects (Tomas et al.), abstract: relative potency. Biochemical Journal (PubMed PMID 7683875), 1993.
  31. Same source as 30: Tomas et al. 1993 (Biochem J, diabetic rats), abstract: muscle protein synthesis.
  32. Same source as 5: Ballard et al. 1993, abstract: plasma clearance.
  33. Same source as 19: BLA 021839 (original approval date).
  34. Warning Letter: Tailor Made Compounding LLC (MARCS-CMS 594743), April 1, 2020. U.S. Food and Drug Administration, 2020.
  35. The 2026 Prohibited List, World Anti-Doping Code: S2.3 Growth factors and growth factor modulators (as published in Tractatenblad 2026, 25). World Anti-Doping Agency; published by the Government of the Netherlands (Tractatenblad), 2026.
  36. Same source as 35: S2 class statement (Tractatenblad 2026, 25).
Shop all peptidesMore healing and recovery peptides